PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna30736.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 260aa    MW: 29444.7 Da    PI: 5.2161
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna30736.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.71.3e-131663148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+W+++Ed +lv +++++G  +W+  ++  g+ R++k+c++rw +yl
  mrna30736.1-v1.0-hybrid 16 KGPWSPDEDHKLVAYIQRYGIWNWSQMPKPAGLARSGKSCRLRWVNYL 63
                             79******************99************************97 PP

2Myb_DNA-binding49.21.2e-1569114148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+++ eE+e ++++ ++ G++ W+ Ia+++  gRt++++k++w+++l
  mrna30736.1-v1.0-hybrid  69 RGNFSREEEETIIKLQQKIGNR-WSVIAAKLS-GRTDNEIKNYWHTHL 114
                              89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-23766IPR009057Homeodomain-like
PROSITE profilePS5129412.9341163IPR017930Myb domain
SuperFamilySSF466891.25E-2813110IPR009057Homeodomain-like
SMARTSM007177.0E-81565IPR001005SANT/Myb domain
PfamPF002495.7E-121663IPR001005SANT/Myb domain
CDDcd001671.08E-61863No hitNo description
PROSITE profilePS5129424.56564118IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2567118IPR009057Homeodomain-like
SMARTSM007176.9E-1568116IPR001005SANT/Myb domain
PfamPF002491.0E-1369114IPR001005SANT/Myb domain
CDDcd001674.83E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MVRGSTQQCD EKRLKKGPWS PDEDHKLVAY IQRYGIWNWS QMPKPAGLAR SGKSCRLRWV  60
NYLRPDIKRG NFSREEEETI IKLQQKIGNR WSVIAAKLSG RTDNEIKNYW HTHLKKRLNN  120
DKSNRVENTS SETETFLVDE EASKASLLET SRENLSPSSS GIADEIDHKP QITEQQSICD  180
TFGELQSLWT HSQVTSTAVE DSEAMFVDSA GLTLSTAADQ VWLQQEPIFP CGSYSDDAHV  240
LMSDYWVNLG VQSDETNGM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-251411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293617.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLM5X3J65e-90M5X3J6_PRUPE; Uncharacterized protein (Fragment)
STRINGVIT_12s0134g00480.t018e-59(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.12e-57myb domain protein 58